PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI06G21880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 595aa    MW: 65527.5 Da    PI: 5.5862
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI06G21880.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-18162209148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT++Ed++l ++v+ +G g+W+++ r  g++R++k+c++rw ++l
  ORUFI06G21880.1 162 KGPWTPDEDKRLREYVEAHGEGNWNRVQRNAGLNRCGKSCRLRWANHL 209
                      79******************************************9986 PP

2Myb_DNA-binding41.92.3e-13215258146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE+e +++++  lG++ W++ a+ ++ gRt++++k++w++
  ORUFI06G21880.1 215 KGPFSKEEEEMIIKLHLWLGNK-WAKMANSLP-GRTDNEIKNFWNT 258
                      79********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.639157213IPR017930Myb domain
SuperFamilySSF466893.48E-30159256IPR009057Homeodomain-like
SMARTSM007175.2E-16161211IPR001005SANT/Myb domain
PfamPF002495.3E-17162209IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-24163216IPR009057Homeodomain-like
CDDcd001676.08E-12164209No hitNo description
PROSITE profilePS5129416.24214264IPR017930Myb domain
SMARTSM007171.9E-12214262IPR001005SANT/Myb domain
PfamPF002494.9E-12215258IPR001005SANT/Myb domain
CDDcd001671.68E-9217258No hitNo description
Gene3DG3DSA:1.10.10.601.1E-23217262IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 595 aa     Download sequence    Send to blast
MQPDSTDRLA GRHAGCSERA ADLHRTKQMI VFRKFTTKSK KHSMQSCKPR LHRWIVLNPN  60
GKPFYYSTSL SAAAAAAAAA HLVSTPGSSP MEEEEEAARL AGSQGESPAM LHPNGDGDGD  120
GGDDEGDASG GEEEQGGVAR AGVRRRGGGG RVRVRGRIPL KKGPWTPDED KRLREYVEAH  180
GEGNWNRVQR NAGLNRCGKS CRLRWANHLK PDLKKGPFSK EEEEMIIKLH LWLGNKWAKM  240
ANSLPGRTDN EIKNFWNTRC KRIQRTGEPL YPKEFNHFKL TDLEVMNCES PDESRAKKRT  300
NEVLQGNGQS YKEVFFDNLD YSRPENYIRP NCVTPNSLPV DATSPFGSAI ATQDQSVPFG  360
SAIVSGHPIL DGNFSTSGTI QRPMNVELPS LQYPNYDFNN NNAWSYHDPL GHPIDQVDFG  420
SLRSEYLSPN NNGLLDALVH GGHGQGELAN SQGSFDACFP RVQCNQVIQS NAFSLSSSFP  480
IIGDDLLENS CHAFVGINNN ASSLFLDSQP PPLVDPTFWR HDVSLEPNLP VYCQFNEELP  540
PSNEQFAKDA DDAFGHGGLS DETNLAAAGQ GDEHDLEDPW ASMPGACDIP DFPSE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-271602625106B-MYB
1h8a_C3e-2716026225126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2120750.0AB212075.1 Oryza sativa Japonica Group mRNA for GAMYB-like1, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641123.10.0PREDICTED: transcription factor GAMYB
TrEMBLA0A0E0PZX70.0A0A0E0PZX7_ORYRU; Uncharacterized protein
STRINGORGLA06G0168900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129022331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.29e-55myb domain protein 101